PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g046158m
Common NameCISIN_1g046158mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 543aa    MW: 62257.3 Da    PI: 8.6718
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g046158mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS362.84.9e-1111635361373
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                        l++lL+ cA+avss+d + a++lL+++++++s +gd  qRla+ f+++L+ar+a+s++++ + l + + + k+ ++ l+a+k++  ++P+ k
  orange1.1g046158m 163 LRTLLILCAQAVSSNDYRTANELLKQIRQHSSLTGDGSQRLAHWFANGLEARMAGSGTGTKSFLMSLAPR-KSAADMLKAYKVYLSACPFKK 253
                        5789***************************************************999999877666665.889****************** PP

               GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlv 182
                        ++ + + ++I++  e+++++Hi+Df+i +G+QWp L+q L+ R++gpp+lRiTg++ p++g   +e++eetg+rL k++++++vpfe+n ++
  orange1.1g046158m 254 LAIMFTIKMIMKVSEKASTLHIVDFGIRYGFQWPMLIQFLSMRTGGPPRLRITGIELPQPGfrPAERIEETGRRLLKYCQRFNVPFEYNCIA 345
                        ************************************************************9*****************************99 PP

               GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                        ++++e++++e+L+++p+E+laVn+ ++ ++llde+v+++ +r++vLkl+++++P+++v +  + ++n++ F++rf ea+ ++s+lfd+++++
  orange1.1g046158m 346 SQNWETIQIEDLKINPDEVLAVNSLFRFKNLLDETVDVNCPRNSVLKLIRKIKPDIFVNSIVNGSYNAPFFVTRFREAIFHFSSLFDMFDTT 437
                        99****************************************************************************************** PP

               GRAS 275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrp 366
                        +pre+ er + Ere+ gre++nv+aceg er+er et+++W++r  +aGFk++pl+++ +++    l+  + + + ++++++++++gWk+r 
  orange1.1g046158m 438 MPREDPERLMFEREVYGREAMNVIACEGLERVERPETYKQWQARTIRAGFKQLPLNQELMEKLMGKLKAWYHKDFVIDQDNNWMLQGWKGRI 529
                        ***********************************************************************888****************** PP

               GRAS 367 LvsvSaW 373
                        +++ S+W
  orange1.1g046158m 530 VFASSCW 536
                        ******* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.568137517IPR005202Transcription factor GRAS
PfamPF035141.7E-108163536IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009410Biological Processresponse to xenobiotic stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
Sequence ? help Back to Top
Protein Sequence    Length: 543 aa     Download sequence    Send to blast
MSSVNEFLAQ NMLSDRESVL QFKKGMEEAS KFLPTGNQLI IDLESYGFST EQKEDTSRVV  60
VKVEKEEREN SPEGSRGRKN HQREDVDLDE ERSNKQSALY TEESELSDMF DKVLLLHVDS  120
NGKPTMCTKG QGEDSLLQKG QSNGSGEKSR SRKQGKRKDT VDLRTLLILC AQAVSSNDYR  180
TANELLKQIR QHSSLTGDGS QRLAHWFANG LEARMAGSGT GTKSFLMSLA PRKSAADMLK  240
AYKVYLSACP FKKLAIMFTI KMIMKVSEKA STLHIVDFGI RYGFQWPMLI QFLSMRTGGP  300
PRLRITGIEL PQPGFRPAER IEETGRRLLK YCQRFNVPFE YNCIASQNWE TIQIEDLKIN  360
PDEVLAVNSL FRFKNLLDET VDVNCPRNSV LKLIRKIKPD IFVNSIVNGS YNAPFFVTRF  420
REAIFHFSSL FDMFDTTMPR EDPERLMFER EVYGREAMNV IACEGLERVE RPETYKQWQA  480
RTIRAGFKQL PLNQELMEKL MGKLKAWYHK DFVIDQDNNW MLQGWKGRIV FASSCWVPAP  540
EL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-461675368374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.178670.0fruit| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006424855.10.0hypothetical protein CICLE_v10027848mg
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLA0A067GBT70.0A0A067GBT7_CITSI; Uncharacterized protein
TrEMBLV4SGX80.0V4SGX8_9R
STRINGPOPTR_0009s03800.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35827189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14